| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein Dihydrodipicolinate synthase [51574] (4 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [141831] (1 PDB entry) |
| Domain d1xxxh1: 1xxx H:5-300 [122440] automatically matched to 1XXX A:5-300 complexed with cl, dtt, mg |
PDB Entry: 1xxx (more details), 2.28 Å
SCOP Domain Sequences for d1xxxh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxxh1 c.1.10.1 (H:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
gfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdg
ekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrg
lqahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqim
adtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkiniav
aplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr
Timeline for d1xxxh1: