Lineage for d1xxxh1 (1xxx H:5-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684065Protein Dihydrodipicolinate synthase [51574] (4 species)
  7. 684094Species Mycobacterium tuberculosis [TaxId:1773] [141831] (1 PDB entry)
  8. 684102Domain d1xxxh1: 1xxx H:5-300 [122440]
    automatically matched to 1XXX A:5-300
    complexed with cl, dtt, mg

Details for d1xxxh1

PDB Entry: 1xxx (more details), 2.28 Å

PDB Description: Crystal structure of Dihydrodipicolinate Synthase (DapA, Rv2753c) from Mycobacterium tuberculosis
PDB Compounds: (H:) Dihydrodipicolinate synthase

SCOP Domain Sequences for d1xxxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxxh1 c.1.10.1 (H:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
gfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdg
ekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrg
lqahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqim
adtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkiniav
aplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr

SCOP Domain Coordinates for d1xxxh1:

Click to download the PDB-style file with coordinates for d1xxxh1.
(The format of our PDB-style files is described here.)

Timeline for d1xxxh1: