Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Dihydrodipicolinate synthase [51574] (13 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [141831] (2 PDB entries) Uniprot P63945 5-300 |
Domain d1xxxh_: 1xxx H: [122440] automated match to d1o5ka_ complexed with cl, dtt, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xxx (more details), 2.28 Å
SCOPe Domain Sequences for d1xxxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxxh_ c.1.10.1 (H:) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} gfdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdg ekiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrg lqahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqim adtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkiniav aplcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr
Timeline for d1xxxh_: