![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Dihydrodipicolinate synthase [51574] (13 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141831] (2 PDB entries) Uniprot P63945 5-300 |
![]() | Domain d1xxxb_: 1xxx B: [122434] automated match to d1o5ka_ complexed with cl, dtt, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xxx (more details), 2.28 Å
SCOPe Domain Sequences for d1xxxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxxb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} fdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdge kiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrgl qahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqima dtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkiniava plcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr
Timeline for d1xxxb_: