Lineage for d1xxwb1 (1xxw B:1-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649301Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries)
  8. 649310Domain d1xxwb1: 1xxw B:1-119 [122432]
    automatically matched to d1a3d__
    complexed with acy, zn

Details for d1xxwb1

PDB Entry: 1xxw (more details), 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
PDB Compounds: (B:) Phospholipase A2 isoform 2

SCOP Domain Sequences for d1xxwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxwb1 a.133.1.2 (B:1-119) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarc

SCOP Domain Coordinates for d1xxwb1:

Click to download the PDB-style file with coordinates for d1xxwb1.
(The format of our PDB-style files is described here.)

Timeline for d1xxwb1: