Lineage for d1xxwb_ (1xxw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733050Species Andaman cobra (Naja sagittifera), isoform 3 [TaxId:195058] [89170] (4 PDB entries)
    heterodimer of two different isoforms
  8. 2733052Domain d1xxwb_: 1xxw B: [122432]
    automated match to d1s6bb_
    complexed with acy, zn

Details for d1xxwb_

PDB Entry: 1xxw (more details), 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
PDB Compounds: (B:) Phospholipase A2 isoform 2

SCOPe Domain Sequences for d1xxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxwb_ a.133.1.2 (B:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 3 [TaxId: 195058]}
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarcn

SCOPe Domain Coordinates for d1xxwb_:

Click to download the PDB-style file with coordinates for d1xxwb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxwb_: