Lineage for d1xxuc1 (1xxu C:1-153)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699993Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species)
  7. 699994Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries)
  8. 699999Domain d1xxuc1: 1xxu C:1-153 [122427]
    automatically matched to 1XVW A:1-153

Details for d1xxuc1

PDB Entry: 1xxu (more details), 1.9 Å

PDB Description: Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin
PDB Compounds: (C:) Hypothetical protein Rv2238c/MT2298

SCOP Domain Sequences for d1xxuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxuc1 c.47.1.10 (C:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}
mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
vdrsgiirfaemkqpgevrdqrlwtdalaalta

SCOP Domain Coordinates for d1xxuc1:

Click to download the PDB-style file with coordinates for d1xxuc1.
(The format of our PDB-style files is described here.)

Timeline for d1xxuc1: