SCOP 1.73: Domain d1xxub1: 1xxu B:1-153

Lineage for d1xxub1 (1xxu B:1-153)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries)

8. Domain d1xxub1: 1xxu B:1-153 [122426]
   automatically matched to 1XVW A:1-153

Details for d1xxub1

PDB Entry: 1xxu, 1.9 Å

PDB Description: Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin

PDB Compounds: (B:) Hypothetical protein Rv2238c/MT2298

SCOP Domain Sequences for d1xxub1:

Sequence; same for both SEQRES and ATOM records:

>d1xxub1 c.47.1.10 (B:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}
mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
vdrsgiirfaemkqpgevrdqrlwtdalaalta

Timeline for d1xxub1:

• d1xxub1 is new in SCOP 1.73
  
• d1xxub1 appears in SCOP 1.75
  
• d1xxub1 appears in the current release, SCOPe 2.08, called d1xxub_