Lineage for d1xxub_ (1xxu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877698Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species)
  7. 2877699Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries)
    Uniprot P65688 1-153
  8. 2877703Domain d1xxub_: 1xxu B: [122426]
    automated match to d1xvwa1

Details for d1xxub_

PDB Entry: 1xxu (more details), 1.9 Å

PDB Description: Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin
PDB Compounds: (B:) Hypothetical protein Rv2238c/MT2298

SCOPe Domain Sequences for d1xxub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxub_ c.47.1.10 (B:) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}
mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
vdrsgiirfaemkqpgevrdqrlwtdalaalta

SCOPe Domain Coordinates for d1xxub_:

Click to download the PDB-style file with coordinates for d1xxub_.
(The format of our PDB-style files is described here.)

Timeline for d1xxub_: