Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily) beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer |
Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) |
Family d.212.1.2: TonB [64326] (1 protein) isolated domain can form different segment-swapped dimers depending on the fragment length automatically mapped to Pfam PF03544 |
Protein TonB [64327] (1 species) |
Species Escherichia coli [TaxId:562] [64328] (6 PDB entries) Uniprot P02929 150-239 |
Domain d1xx3a_: 1xx3 A: [122413] automated match to d1u07a_ |
PDB Entry: 1xx3 (more details)
SCOPe Domain Sequences for d1xx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx3a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]} sgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknam rrwryepgkpgsgivvnilfkingtteiq
Timeline for d1xx3a_: