SCOPe 2.07: Domain d1xx3a_: 1xx3 A:

Lineage for d1xx3a_ (1xx3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families)

5. Family d.212.1.2: TonB [64326] (1 protein)
   isolated domain can form different segment-swapped dimers depending on the fragment length
   automatically mapped to Pfam PF03544

6. Protein TonB [64327] (1 species)

7. Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
   Uniprot P02929 150-239

8. Domain d1xx3a_: 1xx3 A: [122413]
   automated match to d1u07a_

Details for d1xx3a_

PDB Entry: 1xx3

PDB Description: solution structure of escherichia coli tonb-ctd

PDB Compounds: (A:) TonB protein

SCOPe Domain Sequences for d1xx3a_:

Sequence; same for both SEQRES and ATOM records:

>d1xx3a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]}
sgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknam
rrwryepgkpgsgivvnilfkingtteiq

Timeline for d1xx3a_:

• d1xx3a_ first appeared in SCOP 1.73, called d1xx3a1
  
• d1xx3a_ appears in SCOPe 2.06
  
• d1xx3a_ appears in the current release, SCOPe 2.08