Lineage for d1xx3a1 (1xx3 A:164-239)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740002Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 740003Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 740011Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
  6. 740012Protein TonB [64327] (1 species)
  7. 740013Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
  8. 740020Domain d1xx3a1: 1xx3 A:164-239 [122413]
    automatically matched to d1qxxa_

Details for d1xx3a1

PDB Entry: 1xx3 (more details)

PDB Description: solution structure of escherichia coli tonb-ctd
PDB Compounds: (A:) TonB protein

SCOP Domain Sequences for d1xx3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx3a1 d.212.1.2 (A:164-239) TonB {Escherichia coli [TaxId: 562]}
paraqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryepgkpgsg
ivvnilfkingtteiq

SCOP Domain Coordinates for d1xx3a1:

Click to download the PDB-style file with coordinates for d1xx3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xx3a1: