Lineage for d1xx0a1 (1xx0 A:234-350)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805291Protein Pleckstrin [50740] (1 species)
  7. 805292Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 805299Domain d1xx0a1: 1xx0 A:234-350 [122412]
    2nd PH domain

Details for d1xx0a1

PDB Entry: 1xx0 (more details)

PDB Description: structure of the c-terminal ph domain of human pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d1xx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx0a1 b.55.1.1 (A:234-350) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
dvilkeefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlr
gcvvtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasrtgk

SCOP Domain Coordinates for d1xx0a1:

Click to download the PDB-style file with coordinates for d1xx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xx0a1: