SCOP 1.73: Domain d1xwya1: 1xwy A:1-260

Lineage for d1xwya1 (1xwy A:1-260)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins)

6. Protein Deoxyribonuclease TatD (MttC) [141811] (1 species)

7. Species Escherichia coli [TaxId:562] [141812] (1 PDB entry)

8. Domain d1xwya1: 1xwy A:1-260 [122411]
   complexed with zn

Details for d1xwya1

PDB Entry: 1xwy, 2 Å

PDB Description: crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution

PDB Compounds: (A:) Deoxyribonuclease tatD

SCOP Domain Sequences for d1xwya1:

Sequence; same for both SEQRES and ATOM records:

>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]}
mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag
vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl
nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde
rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged
aawlaattdanvktlfgiaf

Timeline for d1xwya1:

• d1xwya1 is new in SCOP 1.73
  
• d1xwya1 appears in SCOP 1.75
  
• d1xwya1 appears in the current release, SCOPe 2.08