![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins) |
![]() | Protein Deoxyribonuclease TatD (MttC) [141811] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141812] (1 PDB entry) |
![]() | Domain d1xwya1: 1xwy A:1-260 [122411] complexed with zn |
PDB Entry: 1xwy (more details), 2 Å
SCOP Domain Sequences for d1xwya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged aawlaattdanvktlfgiaf
Timeline for d1xwya1: