Lineage for d1xwrd1 (1xwr D:4-80)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640498Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. 640499Protein Regulatory protein cII [140521] (1 species)
  7. 640500Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
  8. 640508Domain d1xwrd1: 1xwr D:4-80 [122409]
    automatically matched to 1XWR A:2-80
    complexed with ipa

Details for d1xwrd1

PDB Entry: 1xwr (more details), 2.56 Å

PDB Description: Crystal structure of the coliphage lambda transcription activator protein CII
PDB Compounds: (D:) Regulatory protein CII

SCOP Domain Sequences for d1xwrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwrd1 a.35.1.9 (D:4-80) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailtn

SCOP Domain Coordinates for d1xwrd1:

Click to download the PDB-style file with coordinates for d1xwrd1.
(The format of our PDB-style files is described here.)

Timeline for d1xwrd1: