![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein) Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA |
![]() | Protein Regulatory protein cII [140521] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries) Uniprot P03042 2-80! Uniprot P03042 4-81 |
![]() | Domain d1xwrd_: 1xwr D: [122409] automated match to d1xwra1 complexed with ipa |
PDB Entry: 1xwr (more details), 2.56 Å
SCOPe Domain Sequences for d1xwrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwrd_ a.35.1.9 (D:) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]} ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv dddmarlarqvaailtn
Timeline for d1xwrd_: