Lineage for d1xwrc_ (1xwr C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993669Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1993670Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1994055Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. 1994056Protein Regulatory protein cII [140521] (1 species)
  7. 1994057Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
    Uniprot P03042 2-80! Uniprot P03042 4-81
  8. 1994064Domain d1xwrc_: 1xwr C: [122408]
    automated match to d1xwra1
    complexed with ipa

Details for d1xwrc_

PDB Entry: 1xwr (more details), 2.56 Å

PDB Description: Crystal structure of the coliphage lambda transcription activator protein CII
PDB Compounds: (C:) Regulatory protein CII

SCOPe Domain Sequences for d1xwrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwrc_ a.35.1.9 (C:) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailt

SCOPe Domain Coordinates for d1xwrc_:

Click to download the PDB-style file with coordinates for d1xwrc_.
(The format of our PDB-style files is described here.)

Timeline for d1xwrc_: