Lineage for d1xwrb_ (1xwr B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. Protein Regulatory protein cII [140521] (1 species)
  7. Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
    Uniprot P03042 2-80! Uniprot P03042 4-81
  8. Domain d1xwrb_: 1xwr B: [122407]
    automated match to d1xwra1
    complexed with ipa

Details for d1xwrb_

PDB Entry: 1xwr (more details), 2.56 Å

PDB Description: Crystal structure of the coliphage lambda transcription activator protein CII
PDB Compounds: (B:) Regulatory protein CII

SCOPe Domain Sequences for d1xwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwrb_ a.35.1.9 (B:) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
dddmarlarqvaailtn

SCOPe Domain Coordinates for d1xwrb_ are not available.

Timeline for d1xwrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xwra1, d1xwrc_, d1xwrd_