Lineage for d1xwgb1 (1xwg B:81-214)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641778Protein Class alpha GST [81349] (8 species)
  7. 641798Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (17 PDB entries)
  8. 641808Domain d1xwgb1: 1xwg B:81-214 [122402]
    Other proteins in same PDB: d1xwga2, d1xwgb2
    automatically matched to d1gsea1
    mutant

Details for d1xwgb1

PDB Entry: 1xwg (more details), 1.85 Å

PDB Description: human gst a1-1 t68e mutant
PDB Compounds: (B:) glutathione s-transferase a1

SCOP Domain Sequences for d1xwgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwgb1 a.45.1.1 (B:81-214) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksle

SCOP Domain Coordinates for d1xwgb1:

Click to download the PDB-style file with coordinates for d1xwgb1.
(The format of our PDB-style files is described here.)

Timeline for d1xwgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwgb2