Lineage for d1xwga2 (1xwg A:2-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487517Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2487563Domain d1xwga2: 1xwg A:2-80 [122401]
    Other proteins in same PDB: d1xwga1, d1xwgb1
    automated match to d1gsea2
    mutant

Details for d1xwga2

PDB Entry: 1xwg (more details), 1.85 Å

PDB Description: human gst a1-1 t68e mutant
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1xwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwga2 c.47.1.0 (A:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqerailnyiaskyn

SCOPe Domain Coordinates for d1xwga2:

Click to download the PDB-style file with coordinates for d1xwga2.
(The format of our PDB-style files is described here.)

Timeline for d1xwga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwga1