Lineage for d1xwga1 (1xwg A:81-214)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736229Protein automated matches [226848] (11 species)
    not a true protein
  7. 1736246Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 1736261Domain d1xwga1: 1xwg A:81-214 [122400]
    Other proteins in same PDB: d1xwga2, d1xwgb2
    automated match to d1k3ya1
    mutant

Details for d1xwga1

PDB Entry: 1xwg (more details), 1.85 Å

PDB Description: human gst a1-1 t68e mutant
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1xwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwga1 a.45.1.1 (A:81-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksle

SCOPe Domain Coordinates for d1xwga1:

Click to download the PDB-style file with coordinates for d1xwga1.
(The format of our PDB-style files is described here.)

Timeline for d1xwga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwga2