SCOPe 2.06: Domain d1xwfd1: 1xwf D:190-352

Lineage for d1xwfd1 (1xwf D:190-352)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein S-adenosylhomocystein hydrolase [51845] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)

8. Domain d1xwfd1: 1xwf D:190-352 [122398]
   Other proteins in same PDB: d1xwfa2, d1xwfb2, d1xwfc2, d1xwfd2
   automatically matched to d1d4fa1
   complexed with adn, nad

Details for d1xwfd1

PDB Entry: 1xwf, 2.8 Å

PDB Description: k185n mutated s-adenosylhomocysteine hydrolase

PDB Compounds: (D:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1xwfd1:

Sequence; same for both SEQRES and ATOM records:

>d1xwfd1 c.2.1.4 (D:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

Timeline for d1xwfd1:

• d1xwfd1 first appeared in SCOP 1.73
  
• d1xwfd1 appears in SCOPe 2.05
  
• d1xwfd1 appears in SCOPe 2.07
  
• d1xwfd1 appears in the current release, SCOPe 2.08