Lineage for d1xwfd1 (1xwf D:190-352)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578881Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 1578982Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 1578987Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)
  8. 1579015Domain d1xwfd1: 1xwf D:190-352 [122398]
    Other proteins in same PDB: d1xwfa2, d1xwfb2, d1xwfc2, d1xwfd2
    automatically matched to d1d4fa1
    complexed with adn, nad

Details for d1xwfd1

PDB Entry: 1xwf (more details), 2.8 Å

PDB Description: k185n mutated s-adenosylhomocysteine hydrolase
PDB Compounds: (D:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1xwfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwfd1 c.2.1.4 (D:190-352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOPe Domain Coordinates for d1xwfd1:

Click to download the PDB-style file with coordinates for d1xwfd1.
(The format of our PDB-style files is described here.)

Timeline for d1xwfd1: