SCOPe 2.07: Domain d1xwdd_: 1xwd D:

Lineage for d1xwdd_ (1xwd D:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63397] (9 PDB entries)

8. Domain d1xwdd_: 1xwd D: [122391]
   Other proteins in same PDB: d1xwdb1, d1xwdc1, d1xwde_, d1xwdf_
   automated match to d1dz7a_
   complexed with nag, so4

Details for d1xwdd_

PDB Entry: 1xwd, 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor

PDB Compounds: (D:) Glycoprotein hormones alpha chain

SCOPe Domain Sequences for d1xwdd_:

Sequence; same for both SEQRES and ATOM records:

>d1xwdd_ g.17.1.4 (D:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
nrvtvmggfkvenhtachcstcyyhks

Timeline for d1xwdd_:

• d1xwdd_ first appeared in SCOP 1.73, called d1xwdd1
  
• d1xwdd_ appears in SCOPe 2.06
  
• d1xwdd_ appears in the current release, SCOPe 2.08