Lineage for d1xwdd1 (1xwd D:6-92)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891138Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 891139Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 891311Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 891318Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 891319Species Human (Homo sapiens) [TaxId:9606] [63397] (8 PDB entries)
  8. 891322Domain d1xwdd1: 1xwd D:6-92 [122391]
    Other proteins in same PDB: d1xwdb1, d1xwdc1, d1xwde1
    automatically matched to d1dz7a_
    complexed with bma, nag, so4

Details for d1xwdd1

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (D:) Glycoprotein hormones alpha chain

SCOP Domain Sequences for d1xwdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdd1 g.17.1.4 (D:6-92) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
nrvtvmggfkvenhtachcstcyyhks

SCOP Domain Coordinates for d1xwdd1:

Click to download the PDB-style file with coordinates for d1xwdd1.
(The format of our PDB-style files is described here.)

Timeline for d1xwdd1: