![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) ![]() |
![]() | Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins) |
![]() | Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63397] (8 PDB entries) |
![]() | Domain d1xwda1: 1xwd A:3-92 [122390] Other proteins in same PDB: d1xwdb1, d1xwdc1, d1xwde1 automatically matched to d1dz7a_ complexed with bma, nag, so4 |
PDB Entry: 1xwd (more details), 2.92 Å
SCOP Domain Sequences for d1xwda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwda1 g.17.1.4 (A:3-92) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]} dvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccva ksynrvtvmggfkvenhtachcstcyyhks
Timeline for d1xwda1:
![]() Domains from other chains: (mouse over for more information) d1xwdb1, d1xwdc1, d1xwdd1, d1xwde1 |