SCOP 1.73: Domain d1xwda1: 1xwd A:3-92

Lineage for d1xwda1 (1xwd A:3-92)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)

6. Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63397] (8 PDB entries)

8. Domain d1xwda1: 1xwd A:3-92 [122390]
   automatically matched to d1dz7a_
   complexed with bma, nag, so4

Details for d1xwda1

PDB Entry: 1xwd, 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor

PDB Compounds: (A:) Glycoprotein hormones alpha chain

SCOP Domain Sequences for d1xwda1:

Sequence; same for both SEQRES and ATOM records:

>d1xwda1 g.17.1.4 (A:3-92) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
dvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccva
ksynrvtvmggfkvenhtachcstcyyhks

Timeline for d1xwda1:

• d1xwda1 is new in SCOP 1.73
  
• d1xwda1 appears in SCOP 1.75
  
• d1xwda1 appears in the current release, SCOPe 2.08, called d1xwda_