Lineage for d1xwda_ (1xwd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033866Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 3033876Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 3033877Species Human (Homo sapiens) [TaxId:9606] [63397] (10 PDB entries)
  8. 3033884Domain d1xwda_: 1xwd A: [122390]
    Other proteins in same PDB: d1xwdb1, d1xwdc1, d1xwde_, d1xwdf_
    automated match to d1dz7a_
    complexed with nag, so4

Details for d1xwda_

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (A:) Glycoprotein hormones alpha chain

SCOPe Domain Sequences for d1xwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwda_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
dvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccva
ksynrvtvmggfkvenhtachcstcyyhks

SCOPe Domain Coordinates for d1xwda_:

Click to download the PDB-style file with coordinates for d1xwda_.
(The format of our PDB-style files is described here.)

Timeline for d1xwda_: