SCOPe 2.06: Domain d1xvwb2: 1xvw B:1-153

Lineage for d1xvwb2 (1xvw B:1-153)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries)
   Uniprot P65688 1-153

8. Domain d1xvwb2: 1xvw B:1-153 [122388]
   Other proteins in same PDB: d1xvwa2, d1xvwb3
   automated match to d1xvwa1

Details for d1xvwb2

PDB Entry: 1xvw, 1.9 Å

PDB Description: Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys peroxiredoxin

PDB Compounds: (B:) Hypothetical protein Rv2238c/MT2298

SCOPe Domain Sequences for d1xvwb2:

Sequence; same for both SEQRES and ATOM records:

>d1xvwb2 c.47.1.10 (B:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}
mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefe
nddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfv
vdrsgiirfaemkqpgevrdqrlwtdalaalta

Timeline for d1xvwb2:

• d1xvwb2 first appeared in SCOP 1.73, called d1xvwb1
  
• d1xvwb2 was called d1xvwb_ in SCOPe 2.05
  
• d1xvwb2 appears in SCOPe 2.07
  
• d1xvwb2 appears in the current release, SCOPe 2.08