Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries) Uniprot P65688 1-153 |
Domain d1xvwb_: 1xvw B: [122388] automated match to d1xvwa1 |
PDB Entry: 1xvw (more details), 1.9 Å
SCOPe Domain Sequences for d1xvwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvwb_ c.47.1.10 (B:) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} kvprgshmlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlr dhlpefenddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagi anrgtfvvdrsgiirfaemkqpgevrdqrlwtdalaalta
Timeline for d1xvwb_: