SCOPe 2.05: Domain d1xvwb_: 1xvw B:

Lineage for d1xvwb_ (1xvw B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Putative peroxiredoxin Rv2238c/MT2298 [142381] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142382] (2 PDB entries)
   Uniprot P65688 1-153

8. Domain d1xvwb_: 1xvw B: [122388]
   automated match to d1xvwa1

Details for d1xvwb_

PDB Entry: 1xvw, 1.9 Å

PDB Description: Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys peroxiredoxin

PDB Compounds: (B:) Hypothetical protein Rv2238c/MT2298

SCOPe Domain Sequences for d1xvwb_:

Sequence; same for both SEQRES and ATOM records:

>d1xvwb_ c.47.1.10 (B:) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}
kvprgshmlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlr
dhlpefenddsaalaisvgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagi
anrgtfvvdrsgiirfaemkqpgevrdqrlwtdalaalta

Timeline for d1xvwb_:

• d1xvwb_ first appeared in SCOP 1.73, called d1xvwb1
  
• d1xvwb_ appears in SCOPe 2.04
  
• d1xvwb_ is called d1xvwb2 in SCOPe 2.06
  
• d1xvwb_ appears in the current release, SCOPe 2.08, called d1xvwb2