Lineage for d1xvta1 (1xvt A:4-405)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713098Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 713099Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) (S)
  5. 713100Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (4 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 713127Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. 713128Species Escherichia coli [TaxId:562] [117755] (7 PDB entries)
  8. 713140Domain d1xvta1: 1xvt A:4-405 [122384]
    automatically matched to 1XK6 A:4-405
    complexed with coa

Details for d1xvta1

PDB Entry: 1xvt (more details), 2.3 Å

PDB Description: crystal structure of native caib in complex with coenzyme a
PDB Compounds: (A:) Crotonobetainyl-CoA:carnitine CoA-transferase

SCOP Domain Sequences for d1xvta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvta1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]}
lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
pgqiwrgmpshgmdtaailknigysendiqelvskglakved

SCOP Domain Coordinates for d1xvta1:

Click to download the PDB-style file with coordinates for d1xvta1.
(The format of our PDB-style files is described here.)

Timeline for d1xvta1: