Lineage for d1xvta_ (1xvt A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493184Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 2493211Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. 2493212Species Escherichia coli [TaxId:562] [117755] (7 PDB entries)
    Uniprot P31572
  8. 2493224Domain d1xvta_: 1xvt A: [122384]
    automated match to d1xa3a_
    complexed with coa

Details for d1xvta_

PDB Entry: 1xvt (more details), 2.3 Å

PDB Description: crystal structure of native caib in complex with coenzyme a
PDB Compounds: (A:) Crotonobetainyl-CoA:carnitine CoA-transferase

SCOPe Domain Sequences for d1xvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvta_ c.123.1.1 (A:) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]}
lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
pgqiwrgmpshgmdtaailknigysendiqelvskglakved

SCOPe Domain Coordinates for d1xvta_:

Click to download the PDB-style file with coordinates for d1xvta_.
(The format of our PDB-style files is described here.)

Timeline for d1xvta_: