SCOP 1.73: Domain d1xvma1: 1xvm A:16-239

Lineage for d1xvma1 (1xvm A:16-239)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)

8. Domain d1xvma1: 1xvm A:16-239 [122382]
   automatically matched to d1fn8a_

Details for d1xvma1

PDB Entry: 1xvm, 1.1 Å

PDB Description: Trypsin from Fusarium oxysporum- room temperature to atomic resolution

PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1xvma1:

Sequence; same for both SEQRES and ATOM records:

>d1xvma1 b.47.1.2 (A:16-239) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

Timeline for d1xvma1:

• d1xvma1 is new in SCOP 1.73
  
• d1xvma1 appears in SCOP 1.75
  
• d1xvma1 appears in the current release, SCOPe 2.08, called d1xvma_