Lineage for d1xvma_ (1xvm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2057264Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)
  8. 2057275Domain d1xvma_: 1xvm A: [122382]
    automated match to d1fn8a_

Details for d1xvma_

PDB Entry: 1xvm (more details), 1.1 Å

PDB Description: Trypsin from Fusarium oxysporum- room temperature to atomic resolution
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1xvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvma_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

SCOPe Domain Coordinates for d1xvma_:

Click to download the PDB-style file with coordinates for d1xvma_.
(The format of our PDB-style files is described here.)

Timeline for d1xvma_: