Lineage for d1xvlb_ (1xvl B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2160979Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 2160980Protein Mn transporter MntC [142787] (1 species)
  7. 2160981Species Synechocystis sp. PCC 6803 [TaxId:1148] [142788] (1 PDB entry)
    Uniprot Q79EF9 49-327
  8. 2160983Domain d1xvlb_: 1xvl B: [122381]
    automated match to d1xvla1
    complexed with mn

Details for d1xvlb_

PDB Entry: 1xvl (more details), 2.9 Å

PDB Description: The three-dimensional structure of MntC from Synechocystis 6803
PDB Compounds: (B:) Mn transporter

SCOPe Domain Sequences for d1xvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvlb_ c.92.2.2 (B:) Mn transporter MntC {Synechocystis sp. PCC 6803 [TaxId: 1148]}
ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
nlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirqa
fveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygm
eeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnl
yvdslsteegpvptfldlleydarvitngll

SCOPe Domain Coordinates for d1xvlb_:

Click to download the PDB-style file with coordinates for d1xvlb_.
(The format of our PDB-style files is described here.)

Timeline for d1xvlb_: