Lineage for d1xvlb1 (1xvl B:53-323)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710253Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 710285Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 710293Family c.92.2.2: TroA-like [53811] (5 proteins)
  6. 710294Protein Mn transporter MntC [142787] (1 species)
  7. 710295Species Synechocystis sp. pcc 6803 [TaxId:1148] [142788] (1 PDB entry)
  8. 710297Domain d1xvlb1: 1xvl B:53-323 [122381]
    automatically matched to 1XVL A:49-327
    complexed with mn

Details for d1xvlb1

PDB Entry: 1xvl (more details), 2.9 Å

PDB Description: The three-dimensional structure of MntC from Synechocystis 6803
PDB Compounds: (B:) Mn transporter

SCOP Domain Sequences for d1xvlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvlb1 c.92.2.2 (B:53-323) Mn transporter MntC {Synechocystis sp. pcc 6803 [TaxId: 1148]}
ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm
nlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirqa
fveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygm
eeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnl
yvdslsteegpvptfldlleydarvitngll

SCOP Domain Coordinates for d1xvlb1:

Click to download the PDB-style file with coordinates for d1xvlb1.
(The format of our PDB-style files is described here.)

Timeline for d1xvlb1: