Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.2: TroA-like [53811] (6 proteins) |
Protein Mn transporter MntC [142787] (1 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [142788] (1 PDB entry) Uniprot Q79EF9 49-327 |
Domain d1xvlb_: 1xvl B: [122381] automated match to d1xvla1 complexed with mn |
PDB Entry: 1xvl (more details), 2.9 Å
SCOPe Domain Sequences for d1xvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvlb_ c.92.2.2 (B:) Mn transporter MntC {Synechocystis sp. PCC 6803 [TaxId: 1148]} ekkkvlttftvladmvqnvagdklvvesitrigaeihgyeptpsdivkaqdadlilyngm nlerwfeqflgnvkdvpsvvltegiepipiadgpytdkpnphawmsprnalvyvenirqa fveldpdnakyynanaavyseqlkaidrqlgadleqvpanqrflvscegafsylardygm eeiymwpinaeqqftpkqvqtvieevktnnvptifcestvsdkgqkqvaqatgarfggnl yvdslsteegpvptfldlleydarvitngll
Timeline for d1xvlb_: