SCOPe 2.08: Domain d1xvgf_: 1xvg F:

Lineage for d1xvgf_ (1xvg F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1xvgf_: 1xvg F: [122379]
   Other proteins in same PDB: d1xvga_, d1xvgb_, d1xvgc_, d1xvgd_
   automated match to d1fyzf_
   complexed with brj, ca, fe

Details for d1xvgf_

PDB Entry: 1xvg, 1.96 Å

PDB Description: soluble methane monooxygenase hydroxylase: bromoethanol soaked structure

PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvgf_:

Sequence; same for both SEQRES and ATOM records:

>d1xvgf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1xvgf_:

• d1xvgf_ first appeared in SCOP 1.73, called d1xvgf1
  
• d1xvgf_ appears in SCOPe 2.07