![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
![]() | Domain d1xvff_: 1xvf F: [122373] Other proteins in same PDB: d1xvfa_, d1xvfb_, d1xvfc_, d1xvfd_ automated match to d1fyzf_ complexed with 3cl, fe |
PDB Entry: 1xvf (more details), 2 Å
SCOPe Domain Sequences for d1xvff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvff_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
Timeline for d1xvff_: