Lineage for d1xvff_ (1xvf F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726377Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1726410Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 1726411Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1726412Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1726413Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 1726427Domain d1xvff_: 1xvf F: [122373]
    Other proteins in same PDB: d1xvfa_, d1xvfb_, d1xvfc_, d1xvfd_
    automated match to d1fyzf_
    complexed with 3cl, fe

Details for d1xvff_

PDB Entry: 1xvf (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: chloropropanol soaked structure
PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvff_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

SCOPe Domain Coordinates for d1xvff_:

Click to download the PDB-style file with coordinates for d1xvff_.
(The format of our PDB-style files is described here.)

Timeline for d1xvff_: