SCOP 1.75: Domain d1xvff1: 1xvf F:4-168

Lineage for d1xvff1 (1xvf F:4-168)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1xvff1: 1xvf F:4-168 [122373]
   Other proteins in same PDB: d1xvfa1, d1xvfb1, d1xvfc1, d1xvfd1
   automatically matched to d1fyzf_
   complexed with 3cl, fe

Details for d1xvff1

PDB Entry: 1xvf, 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: chloropropanol soaked structure

PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xvff1:

Sequence; same for both SEQRES and ATOM records:

>d1xvff1 a.23.3.1 (F:4-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xvff1:

• d1xvff1 first appeared in SCOP 1.73
  
• d1xvff1 is called d1xvff_ in SCOPe 2.01
  
• d1xvff1 appears in the current release, SCOPe 2.08, called d1xvff_