Lineage for d1xvde_ (1xvd E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312673Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2312674Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2312675Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2312676Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 2312707Domain d1xvde_: 1xvd E: [122360]
    Other proteins in same PDB: d1xvda_, d1xvdb_, d1xvdc_, d1xvdd_
    automated match to d1fyzf_
    complexed with fe, fpn

Details for d1xvde_

PDB Entry: 1xvd (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvde_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOPe Domain Coordinates for d1xvde_:

Click to download the PDB-style file with coordinates for d1xvde_.
(The format of our PDB-style files is described here.)

Timeline for d1xvde_: