Lineage for d1xvdd_ (1xvd D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729259Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1729260Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1729294Domain d1xvdd_: 1xvd D: [122359]
    Other proteins in same PDB: d1xvda_, d1xvdb_, d1xvde_, d1xvdf_
    automated match to d1fyzc_
    complexed with fe, fpn

Details for d1xvdd_

PDB Entry: 1xvd (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure
PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xvdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvdd_ a.25.1.2 (D:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xvdd_:

Click to download the PDB-style file with coordinates for d1xvdd_.
(The format of our PDB-style files is described here.)

Timeline for d1xvdd_: