Lineage for d1xvdd1 (1xvd D:2-389)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639192Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 639193Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 639225Domain d1xvdd1: 1xvd D:2-389 [122359]
    Other proteins in same PDB: d1xvda1, d1xvdb1, d1xvde1, d1xvdf1
    automatically matched to d1fyzc_
    complexed with fe, fpn

Details for d1xvdd1

PDB Entry: 1xvd (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure
PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xvdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvdd1 a.25.1.2 (D:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1xvdd1:

Click to download the PDB-style file with coordinates for d1xvdd1.
(The format of our PDB-style files is described here.)

Timeline for d1xvdd1: