Lineage for d1xvce_ (1xvc E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987222Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1987255Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 1987256Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1987257Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1987258Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 1987275Domain d1xvce_: 1xvc E: [122354]
    Other proteins in same PDB: d1xvca_, d1xvcb_, d1xvcc_, d1xvcd_
    automated match to d1fyzf_
    complexed with 5br, bmm, br, fe, fmt

Details for d1xvce_

PDB Entry: 1xvc (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvce_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOPe Domain Coordinates for d1xvce_:

Click to download the PDB-style file with coordinates for d1xvce_.
(The format of our PDB-style files is described here.)

Timeline for d1xvce_: