Lineage for d1xvcc_ (1xvc C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. Domain d1xvcc_: 1xvc C: [122352]
    Other proteins in same PDB: d1xvca_, d1xvcb_, d1xvce_, d1xvcf_
    automated match to d1fyzc_
    complexed with 5br, bmm, br, fe, fmt

    has additional insertions and/or extensions that are not grouped together

Details for d1xvcc_

PDB Entry: 1xvc (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xvcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvcc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xvcc_ are not available.

Timeline for d1xvcc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xvca_, d1xvcb_, d1xvcd_, d1xvce_, d1xvcf_