| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold |
| Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
| Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
| Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries) |
| Domain d1xvbf1: 1xvb F:4-168 [122349] Other proteins in same PDB: d1xvba1, d1xvbb1, d1xvbc1, d1xvbd1 automatically matched to d1fyzf_ complexed with 3br, bbu, bbx, bhl, ca, fe |
PDB Entry: 1xvb (more details), 1.8 Å
SCOP Domain Sequences for d1xvbf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvbf1 a.23.3.1 (F:4-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1xvbf1: