SCOPe 2.08: Domain d1xvbf_: 1xvb F:

Lineage for d1xvbf_ (1xvb F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1xvbf_: 1xvb F: [122349]
   Other proteins in same PDB: d1xvba_, d1xvbb_, d1xvbc_, d1xvbd_
   automated match to d1fyzf_
   complexed with 3br, bbu, bbx, bhl, ca, fe

Details for d1xvbf_

PDB Entry: 1xvb, 1.8 Å

PDB Description: soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure

PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvbf_:

Sequence; same for both SEQRES and ATOM records:

>d1xvbf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1xvbf_:

• d1xvbf_ first appeared in SCOP 1.73, called d1xvbf1
  
• d1xvbf_ appears in SCOPe 2.07