![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
![]() | Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
![]() | Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
![]() | Domain d1xvbe_: 1xvb E: [122348] Other proteins in same PDB: d1xvba_, d1xvbb_, d1xvbc_, d1xvbd_ automated match to d1fyzf_ complexed with 3br, bbu, bbx, bhl, ca, fe |
PDB Entry: 1xvb (more details), 1.8 Å
SCOPe Domain Sequences for d1xvbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvbe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1xvbe_: