SCOPe 2.01: Domain d1xvbe_: 1xvb E:

Lineage for d1xvbe_ (1xvb E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1xvbe_: 1xvb E: [122348]
   Other proteins in same PDB: d1xvba1, d1xvbb1, d1xvbc_, d1xvbd_
   automated match to d1fyzf_
   complexed with 3br, bbu, bbx, bhl, ca, fe

Details for d1xvbe_

PDB Entry: 1xvb, 1.8 Å

PDB Description: soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure

PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvbe_:

Sequence; same for both SEQRES and ATOM records:

>d1xvbe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xvbe_:

• d1xvbe_ first appeared in SCOP 1.73, called d1xvbe1
  
• d1xvbe_ was called d1xvbe1 in SCOP 1.75
  
• d1xvbe_ appears in SCOPe 2.02
  
• d1xvbe_ appears in the current release, SCOPe 2.08