SCOP 1.75: Domain d1xvbe1: 1xvb E:3-168

Lineage for d1xvbe1 (1xvb E:3-168)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1xvbe1: 1xvb E:3-168 [122348]
   Other proteins in same PDB: d1xvba1, d1xvbb1, d1xvbc1, d1xvbd1
   automatically matched to d1fyzf_
   complexed with 3br, bbu, bbx, bhl, ca, fe

Details for d1xvbe1

PDB Entry: 1xvb, 1.8 Å

PDB Description: soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure

PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xvbe1:

Sequence; same for both SEQRES and ATOM records:

>d1xvbe1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1xvbe1:

• d1xvbe1 first appeared in SCOP 1.73
  
• d1xvbe1 is called d1xvbe_ in SCOPe 2.01
  
• d1xvbe1 appears in the current release, SCOPe 2.08, called d1xvbe_