Lineage for d1xvbc1 (1xvb C:2-389)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639192Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 639193Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 639196Domain d1xvbc1: 1xvb C:2-389 [122346]
    Other proteins in same PDB: d1xvba1, d1xvbb1, d1xvbe1, d1xvbf1
    automatically matched to d1fyzc_
    complexed with 3br, bbu, bbx, bhl, ca, fe

Details for d1xvbc1

PDB Entry: 1xvb (more details), 1.8 Å

PDB Description: soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xvbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvbc1 a.25.1.2 (C:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1xvbc1:

Click to download the PDB-style file with coordinates for d1xvbc1.
(The format of our PDB-style files is described here.)

Timeline for d1xvbc1: